DPCstruct | MC4236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8BH25 | 1-117 | MSRFYEIEPTAENYWRAIILFGRNSASYKFALAKTLFDFQSLGKTQITLEELAVPYAAHLCEHLKKHPKQGTSEQSTFLDKLRAFNQ… |
| W9H266 | 1-106 | MRLRANMNGFFNVEPTTENRWRAIILFGRNTASFKFALGEALLSAGTASGDLIRLDGLALPYAKAICRHLQNAPKQITTSAGQFLKA… |
| A0A2A5EL30 | 1-96 | None |
| A0A348MV75 | 1-126 | None |
| A0A6N7C2X5 | 1-121 | None |
| K0YKU9 | 1-128 | None |
| A0A6P1KI76 | 1-118 | None |
| A0A7T9SYM5 | 1-118 | None |
| A0A1V2LVH4 | 5-99 | None |
| R4Z0Y6 | 4-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.