DPCstruct | MC42351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 55.01 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0125- CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378MZ29 | 1-80 | MTVHGDSAVAGQGVVQETLNMANVRGYKVGGTIRIVINNQIGFTTSNPNDTAPRILYDIAKMIQAPIIHVNVMIRKLLLC |
| A0A0B8PDS8 | 25-103 | TIHGDSAIAGQGVVQETFNMSQARGFQVGGTVRIVVNNQIGFTTSNPRDTRSTMYCTDIAKMVQAPIFHVNADDPEAVA |
| A0A0R3QJ99 | 87-164 | None |
| A0A090KZX9 | 636-711 | None |
| A0A6A6L5V0 | 2-68 | None |
| A0A0N4VVX6 | 4-87 | None |
| A0A376RMG9 | 1-80 | None |
| B7G118 | 484-561 | None |
| A0A1W6WXV4 | 50-128 | None |
| B7GDZ1 | 14-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.