DPCstruct | MC42350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 6.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378MZ12 | 1-83 | MPELDYKYHGFTDEDLNETFTVGRYVYDKDTMKLSELDKALKETYLGPIGLEFMHVQDIEQRNWLQAKMESVLNKRCSPKQKN |
| A0A377B3H3 | 6-83 | VADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLEALKQTYCGPIGAEYMHITSTEEKRWIQQRIESGRATFNS |
| A0A3P8M4S5 | 1-84 | None |
| B9SR44 | 31-115 | None |
| A0A7R9GYU7 | 229-319 | None |
| T1C7R2 | 30-108 | None |
| A0A496KWN9 | 1-67 | None |
| A0A2G7FVE2 | 93-185 | None |
| A0A7J7ASJ5 | 88-170 | None |
| A0A378BSX3 | 49-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.