DPCstruct | MC4235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Standard deviation of domain lengths | 23.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5Z908 | 103-234 | DQNNDLMGFMSNWFIGSISFNCKNFTSTCSTYKVWYNNSNKRLEGWAWSPIIGWVHFNTTTYSVNFNSSTNEFYGYAWNDVIGWIKF… |
| A0A1G2F1U0 | 27-178 | YFTKPEIASGGTEHNVSGWGWSDYIGWISFNSTSGGGSYNYGINVDFGTGNFSGYAWSDNVGWITFAPVGPYPADPQRAAHLESDYK… |
| A0A7V3QFM8 | 21-167 | None |
| A0A2H0BM81 | 18-169 | None |
| A0A1F8Q141 | 23-163 | None |
| A0A0G0W613 | 12-146 | None |
| A0A832AK12 | 6-151 | None |
| A0A7X6DTI3 | 104-239 | None |
| A0A0G0YCP8 | 1-214 | None |
| A0A2G9Z348 | 14-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.