DPCstruct | MC42348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 136 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9PWC5 | 289-421 | GTDDRHIEEHNPLLASMGITARDFFDMINELDPQEKELFRDVDSSTMLGCIQNDILHNLPASEKVPVSHNDSSIMIFACHDPMREVE… |
| C0AT27 | 136-276 | FNEEGEQNIGNPLLASWGKLGKDNLYFLSELEYTDVLDAFVDIPRDNLLHQLQADILDLEDFSQLGTTLETYECSENKRVILPDDNS… |
| A0A090P9L0 | 100-235 | None |
| A0A447N4H4 | 27-167 | None |
| A0A0B8QN47 | 42-169 | None |
| A0A2X4Z8R6 | 14-156 | None |
| A0A5C2HHW2 | 306-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.