DPCstruct | MC42343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 146 ± 34 aa |
| Standard deviation of domain lengths | 33.83 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.42 |
| Pfam Score | 95.80 |
| Assigned Pfam label(s) | PF17042- PF07005- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A515EV09 | 284-420 | AQPVAPSPWRVSAAPWVLVGSVNPVSHAQAATLALACPTVPLLLTRLVRSDPLTATQALVAQLAQAIQSGQCDGVVVTGGETAKALA… |
| A0A447L1Z4 | 2-102 | YATAEPDTLQQIQRQYGVDAASHAVEALFAALVKQLQQAGFSRFIVAGGETSGVVTQALAIRGFHIGPCISPGVPWVRAIEQPVSLA… |
| A0A0S9D6Y8 | 2-79 | None |
| A0A377M0R9 | 8-84 | None |
| A0A345XTV3 | 291-452 | None |
| A0A5N5K3P2 | 38-236 | None |
| C9SN39 | 26-199 | None |
| A0A2E2YTC9 | 37-181 | None |
| A0A835UG38 | 428-610 | None |
| A0A1Q6V0P2 | 298-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.