DPCstruct | MC42340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F4ANZ1 | 41-174 | TAVQSRAIADFTEFAGSEANAQSLVFGLRNGRRITLVGAMRGRRLCVTTFTPPTQPLGNGSIYLSLLMAADRLAAFRITSPTPQQLQ… |
| A0A1G3H8D1 | 14-130 | LVRLTRQYAAFAGTTRNALSLISGLRAGNTITLHAADEDASFTPPTAPMGWGRVQRILNLARAGLASLGIGAPLPLQMAAALMGGTI… |
| A0A521Z1W8 | 1-136 | None |
| A0A521YXB2 | 1-160 | None |
| A0A370K293 | 9-166 | None |
| A0A6I1R872 | 3-128 | None |
| A0A536SPM7 | 1-138 | None |
| A0A537DKM1 | 32-176 | None |
| A0A1F7TF90 | 1-169 | None |
| A0A537A1G5 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.