DPCstruct | MC4234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 15.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.69 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | CL0044- PF03477- PF15686 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A200RBI9 | 163-267 | MPGLTFSNELISRDEGLHCDFACLLYSLLQKPLDLQKVHQIVHEAVEIETEFVCDALPCALIGMNSDLMSQYIMFVADRLLVSLGYQ… |
| A0A7X9Y9G7 | 14-108 | KEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQ… |
| G0NY73 | 636-761 | None |
| A0A7R9PU46 | 83-194 | None |
| A0A7R9KFU0 | 374-494 | None |
| A0A556TPS2 | 143-248 | None |
| A0A250XRW2 | 337-472 | None |
| A0A4Y7T852 | 31-132 | None |
| B7XP28 | 18-135 | None |
| A0A3M4W723 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.