DPCstruct | MC42336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 109 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820A6N4 | 26-137 | KSIDGGSDCASCTVIVGLVEKLSIVYNESVISSLERLCNALPTDLRVYCRVAVDFLGPLIIDGFMKGDSPDIICHALKFCTDDPGQA… |
| A0A2T7NHC7 | 25-134 | LTRGVNGGVDCATCFVIVSLVEQLGEIHNESVVNSTARLCSYLPGKYQQFCKEFVDAFGPILFKLIEDDANPDRVCASLDFCRTDPG… |
| A0A7M4EVF7 | 15-111 | None |
| A0A819H1X5 | 4-116 | None |
| A0A2J7R4E4 | 19-129 | None |
| A0A835TV43 | 40-152 | None |
| A0A6J3RXJ4 | 35-140 | None |
| A0A7J7TLA1 | 39-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.