DPCstruct | MC42334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 179 ± 26 aa |
| Standard deviation of domain lengths | 26.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LBR4 | 15-163 | DVRQHHVTPEEIQKEIAEIEEKTSLMVKKGIELEDRLREEMKDDASEESEELLMEWFEVVNEKNQLVRREGELVAQAQIQDLEIQHA… |
| A0A672UU87 | 33-215 | SPPRARPPALTPPFMCHPLTPHTETPAEEETPRLRDTSQFVVAELAALEREQERVDARAVTLERELRGLMQSGADPPREEQLIQEWF… |
| A0A0B1TGD3 | 2-298 | None |
| A0A814QS21 | 438-621 | None |
| A0A3Q1EGK8 | 899-1083 | None |
| A0A498NYN9 | 2-139 | None |
| A0A673WM24 | 766-935 | None |
| A0A3B5QU29 | 29-196 | None |
| A0A1D1W9G6 | 364-541 | None |
| A0A835CMF5 | 753-930 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.