DPCstruct | MC42331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 619 ± 75 aa |
| Standard deviation of domain lengths | 75.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8PAR1 | 1-760 | MDTYSRPVQPNSGPNDFQQLAGALAQISPSLQGFLETQSATMQKDAEDRAMKRIGGMSFAEAQSAVADGSISEMDNPWFKAAFMKQY… |
| A0A3S3DLU1 | 1-580 | MDTIRGRAYDEAGTKTYLQLVDSEMRSTTQQLFEQYRDDPAGLEQSLGVLKQTLRKDHIFPEIEADYDVGFDRLAGAYLGQARENLA… |
| A0A6L9M028 | 2-649 | None |
| A0A661F1B7 | 7-661 | None |
| A0A5C1WEK1 | 1-605 | None |
| A0A2E6Y855 | 202-849 | None |
| A0A7S9RBJ3 | 2-546 | None |
| A0A2E0GZE8 | 12-747 | None |
| A0A4R3G070 | 1-666 | None |
| A0A523QWZ2 | 1-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.