DPCstruct | MC4233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 6.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 20.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3CH71 | 4-83 | HMPNHKRRRLVQIHECVDDRGNPVVVEEYQTEVAFAPLSGPLEWRKSARDLITDSGDPVNFVSEGVFQLVLTDMIVRVES |
| A0A7X9TV14 | 1-77 | MTSAIESGSFIAKCGSGKKYKVIEKTKETNEPSTHYKQVFVTIQKSYFLSTGEAVNKLSDKHYLIVKNQIIISRTEA |
| A0A0Q6KFM0 | 5-70 | None |
| A0A0D0N1P2 | 3-77 | None |
| A0A4Q3MIN1 | 1-63 | None |
| A0A7Z6TZ32 | 65-136 | None |
| A0A5C0AVC2 | 1-76 | None |
| A0A109CAK0 | 3-82 | None |
| A0A836Q421 | 722-801 | None |
| A0A543LUP3 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.