DPCstruct | MC42329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9EPA0 | 1-111 | MAGIRLHVVAPLVLAAVKKCARDPSACVRKCAAYALCKLCDLLPDESTALKEIVDVLFADNSPGVVGASAVAFKSVCPSGLTLISKH… |
| A0A6I9NDV4 | 48-153 | RVTIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLYSLDPEQKDQLIEVIEKLLADKTTLVAGSVVMAFEEVCPERIELIHKNYRKL… |
| A0A7J8YDE4 | 1-102 | None |
| A0A818LZ70 | 3-100 | None |
| A0A2R6WW60 | 131-238 | None |
| A0A7J9FL88 | 1-90 | None |
| F0Y5W5 | 222-314 | None |
| A0A0P5R4N7 | 145-240 | None |
| A0A814I4N1 | 505-600 | None |
| A0A4Y7LLE5 | 433-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.