DPCstruct | MC42325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452Z112 | 258-323 | AEQLGAVCCSEVDPSVTHVVAVHAGTEKARWAVKHKKFLLHPRWIEACNYRWHRQPEEDFPVPGLK |
| A0A251UAC3 | 494-560 | AERLGATCSTEVDSSVTHVISTDIGTEKSRWAIQENKFLVEPRWLEAANFLWQRLPEESFPVKFPDV |
| A0A7S1T245 | 116-183 | None |
| A0A061DZA3 | 170-237 | None |
| A0A067GKL5 | 218-279 | None |
| A0A6P5MHS5 | 192-256 | None |
| A0A830CWN5 | 1-70 | None |
| A0A2P6QK53 | 8-88 | None |
| W1NPN8 | 531-595 | None |
| A0A452Z119 | 132-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.