DPCstruct | MC42314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 167 ± 17 aa |
| Standard deviation of domain lengths | 16.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9XGP6 | 69-209 | LLVMDHSAQLPDRCIKCNAQSKIRLKRKLYWHSPAYYLLIVAGVLVYAIVAMAIRKTAVIEVGLCDLHSTKRRNGIWISWGIFALSL… |
| A0A7C4YJH6 | 2-178 | PRVRLLKTETRPAAQPPLCLICGRPATCHVSKQFSWRPPWLTYSFWSAVLCFFPAAVVILALGFAQTRRATVETPLCARHRGYWNWR… |
| A0A7C7QCW4 | 3-173 | None |
| A0A142X5K4 | 9-189 | None |
| A0A0Q7XCZ7 | 11-167 | None |
| A0A6L5EPG0 | 3-155 | None |
| A0A7J9ZA98 | 2-165 | None |
| A0A1F8P4G4 | 286-469 | None |
| A0A1C5HDB3 | 58-236 | None |
| A0A3M1T2Z4 | 2-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.