DPCstruct | MC42313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9XAG1 | 2-124 | NFLTEDSILMCPHGGTVQLKGRGKPSFKINGQAVICLSGLIGAPFDDKCTQVGPGLKPCTTVTSVTAGFARPMVVGRSTPLLSSVQA… |
| A0A825EVX9 | 1-120 | MHPILEDNTLVCLHGGRVKLKAKKAKRIKSDNVSIMLDNEIQGASISGCLNPPILGGPCTKVAMVFAYTYSDHKVNNKHSVLQMGLI… |
| N2BBQ2 | 177-305 | None |
| A0A809NF42 | 3-142 | None |
| A0A809NHP1 | 1-82 | None |
| A0A809NK18 | 248-363 | None |
| A0A810LCK6 | 3-106 | None |
| A0A2A4L843 | 41-159 | None |
| A0A286DXR0 | 9-116 | None |
| A0A2M9JRC7 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.