DPCstruct | MC42305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z3R4N1 | 3-109 | VQDDLLTYYADRYQIVAFWSLRTADRKIVLGNKDNRVCRFCGKAEPEVTFRKDAHAFPECIGNKSLFTHYECDTCNHAFGSGCENDF… |
| A0A1B8Q4S0 | 144-243 | AFLETYDIHGRSSENKFTVGELDKSKRVCRFCKKDSKETSFKKRAHAISEALGNKHLLLGEECDDCNQLFSRTLEKDFLLTVRLFNT… |
| A0A2E0YRZ4 | 45-143 | None |
| A0A227JQK2 | 211-282 | None |
| A0A4R1NPI4 | 16-123 | None |
| A0A2H3P3I2 | 3-125 | None |
| A0A0C2NLV0 | 1-96 | None |
| A0A1Q6HNS1 | 75-172 | None |
| A0A316SBY4 | 11-96 | None |
| A0A4P2Q6R9 | 23-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.