DPCstruct | MC42301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392RLZ4 | 1-90 | MPLGTIARLVEKESSIGPVSVGCLNSLYHSVANLDDGCMWNERSKQVLLQPSNLAEDYCNTLKLNIDDTQPAKFIVCNNYTNCTYDS… |
| A0A314UG39 | 28-106 | DFVDVLCSFLTIPMGTIVRLARSRSLPVGIGCMNCLYESAKSMDSKVFRAEKCQDMLLFPRNRGSSLMGKLKLNIDDSD |
| A0A2U1N8P9 | 10-88 | None |
| A0A2Z6P306 | 33-132 | None |
| A0A445EB83 | 19-106 | None |
| A0A2K3KMZ8 | 31-119 | None |
| A0A5P1EC50 | 25-102 | None |
| A0A3N6S2F2 | 57-149 | None |
| A0A5N6N2D6 | 18-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.