DPCstruct | MC42300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 81 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392RHK2 | 1-70 | MPKLRHLSMSGNLLTNVGLDAILEGCLLLESLYLQNCFHLDLSGSLEKRCRDQIKDLTLPTVIDENCDDE |
| A0A6D2K502 | 98-162 | MPQLRRLQLFGNQLTEYGLNIILDSCPHLEHLDLRKCFNVELVGDLEKRCLERIKDLRRPHDSTT |
| A0A6B9VB13 | 80-156 | None |
| A0A4U6UDL5 | 139-245 | None |
| A0A0D3GX65 | 160-264 | None |
| A0A1U7W2K2 | 131-212 | None |
| A0A6J1EMJ1 | 182-264 | None |
| A0A4Y1RB11 | 315-405 | None |
| M8A9S3 | 369-448 | None |
| B9FZG9 | 302-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.