DPCstruct | MC42296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9Y0Z5 | 3-81 | PNNRAVALRVPRAPGAQEVAPYTTATAMPAGWIWTIPLDQRDGTGYVYSDQFCTPEEAERTLREFAAPGSDDLPANHVA |
| X8FF79 | 62-151 | EPFIDMNDHLLCDSAVATPIRHDDAANGIEPYTSAIAMRYGWTWRTPLLGRFGSGYVYSSQFASQDEAIRDFCNLWQLDPEDTPLNK… |
| A0A2V6T2M8 | 557-638 | None |
| A0A368T958 | 763-844 | None |
| A0A1V4BN02 | 40-127 | None |
| G7TJG7 | 1-89 | None |
| A6G2J2 | 217-298 | None |
| A0A2N0IV36 | 219-306 | None |
| A0A235J722 | 609-690 | None |
| A0A850KRQ4 | 232-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.