DPCstruct | MC42293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420R4D4 | 228-319 | TPEQGYDDLLRSMRDILDWSSRPAQERPKVHMVVSALHDHVQGEGKFVEVDDVVHSYLYENGDNPFEDDKYVIWPGQGGVQRDIFNP… |
| A0A553HWL3 | 5-95 | IRTIELNWLNTNKICHHSLLRQIKDTLGWQDRILRPRLSFVLDPPGYDLYHAIWVEKEVHEFLYEGGVNPFRNRRGPVPGGVGIVID… |
| A0A094DTX1 | 124-216 | None |
| A0A0G4PTE0 | 3-85 | None |
| T0KGG4 | 468-559 | None |
| A0A484FFR0 | 107-220 | None |
| K3VYT2 | 66-158 | None |
| W9NBI9 | 1-121 | None |
| A0A1S9S0Z2 | 97-211 | None |
| A0A2T3B4S2 | 198-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.