DPCstruct | MC42291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Standard deviation of domain lengths | 27.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6S5T5 | 70-171 | TGFHLLIPFALRPNLADKDGARRSDGTLVPSGSFTQLFQHGVFYPFGGEHRAQRLERLFDRWTELIESGVWTVGENGVEGGIDMFQD… |
| A0A094BLQ2 | 738-861 | HGLWTGYVDKESDHVFEDSCCLHLPFEIGVNGFARYADDSLIGDNQEGSVARPNGRRNDLYQLGYNHYGPAHGPQLGDILDLWQNLV… |
| A0A2P2HI21 | 89-227 | None |
| A0A6G1HHE3 | 7-133 | None |
| A0A6A6GB98 | 411-518 | None |
| A0A6A6TWT7 | 392-511 | None |
| A0A2V1BK87 | 114-296 | None |
| A0A093X3Y8 | 146-312 | None |
| A0A4Q4M4K6 | 800-940 | None |
| A0A4U0WZ99 | 203-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.