DPCstruct | MC4229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 229 ± 21 aa |
| Standard deviation of domain lengths | 20.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.36 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF11863- PF04984 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0YKK7 | 103-349 | AAATGKITVTGTATASGTLALYIAGHRVRVGVTAADTQVVITQAIVDAINAKTDLPVTAAVNATNTNEVDVTARNAGEAGNDIDIRA… |
| A0A843Q727 | 3-240 | GQATAAAMNLTGTVTRDGIVYACVGGRRYTLPAPKGKKGKELTDELAALINADPDAPFTASSGAGSGDNGAGLKGSLGITARFTGEC… |
| A0A072TPP1 | 96-333 | None |
| A0A3B0IWK1 | 5-246 | None |
| A0A090E4F1 | 269-506 | None |
| A0A6N8Q6E9 | 4-244 | None |
| A0A2X2FEE6 | 12-195 | None |
| G6XIS2 | 45-283 | None |
| A0A2X2ZY06 | 98-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.