DPCstruct | MC42287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 118 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.70 |
| Pfam Score | 87.88 |
| Assigned Pfam label(s) | CL0103- PF16335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6RFU8 | 44-158 | GKVSGKLSVNFVVGALSFFLDDYNSALTESLKLDQELVTLSAVAAGSKYADILALPTRQAYRGIDLFIPKGSLDTDEVLAFIKEISS… |
| A0A0U4ZDP4 | 359-464 | WTSYFSSALEALDFFHHDYRDSNALSSALDDRIAQDSLAAAGQDYLTITSLSTRQAFAATQLTGTIESPYIFMKEISSNGNMNTVDV… |
| A0A815KRV6 | 68-180 | None |
| A0A2P2H2M5 | 606-724 | None |
| A0A2S8PK25 | 33-146 | None |
| A0A0C9WLD3 | 152-273 | None |
| A0A821AI90 | 41-169 | None |
| A0A7V7D3V0 | 5-118 | None |
| A0A533YNZ7 | 184-295 | None |
| A0A0M3C648 | 431-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.