DPCstruct | MC42284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0WEF9 | 70-139 | MKKYDMIPKHSFFQGVAAGLFCILPEHFYDKVEEESIILKPSKTFEFIKNGVLIEGDATPINADVVIYAT |
| A0A287Y1M1 | 14-83 | MKKHDMVPDHSFFEGMVGCMLSTTPKDHYKNLEEGIIVIKKSKTFGFCKEGVLVEGESTFVKSDIVIFGT |
| A0A835UDV8 | 1-82 | None |
| A0A835RJP9 | 1-70 | None |
| A0A6A6LQ44 | 12-78 | None |
| A0A0B2S7X7 | 121-178 | None |
| A0A0D3DWI4 | 2-74 | None |
| A0A453LJN1 | 3-65 | None |
| A0A453LJ65 | 1-65 | None |
| A0A287Y197 | 14-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.