DPCstruct | MC42283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0WEF9 | 67-172 | TIPMKKYDMIPKHSFFQGVAAGLFCILPEHFYDKVEEESIILKPSKTFEFIKNGVLIEGDATPINADVVIYATGYKGDQKLKNMFIS… |
| A0A453LJN1 | 1-117 | MGMVPDYSFSFAMSSCLFAMLAIGFHDRVDEGSIILKKSKRFSFSSNGIILEEGNECIKSDIIILATGFSGDQKLRDIFATNWCRNI… |
| A0A835RJP9 | 2-117 | None |
| A0A6A6LRS6 | 271-366 | None |
| A0A6A6LQ44 | 8-119 | None |
| A0A078G5D2 | 125-227 | None |
| A0A061DYH5 | 209-336 | None |
| A0A2I0WAU1 | 1-102 | None |
| A0A4S8IMH5 | 288-400 | None |
| A0A1U7VY07 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.