DPCstruct | MC42282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 52 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 63.32 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0077- CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287FAI9 | 235-286 | NVLQLEVVTGRGEAVTCSPTKDAELFSAVLGGLGQFGIITRARILLQEAPQK |
| A0A2G9GBA2 | 126-177 | INNVYQLQVVTGRGEVETCSEEQNTDLFHAVLGGLGQFGIITKARIALEPAP |
| A0A3L6QIX4 | 80-141 | None |
| A0A811PDG8 | 46-97 | None |
| A0A287XYJ6 | 2-53 | None |
| A0A0K9Q6B2 | 2-45 | None |
| A0A2J6LDV7 | 40-91 | None |
| A0A314ZEV2 | 160-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.