DPCstruct | MC4228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 8.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S0MCV2 | 1-97 | MADIDRVRLRFEEAIAALALRTELRGTATYRDLTGDEHRRAFAVAGAMKADLLADLREAVQRAVEDGVGLEAFRTDFWGTVKKHGWH… |
| A0A2X3DFM1 | 3-87 | GNIAYGSLPFREQLAFFQRKLNTKTDAWTDVYGDEHDNEFMVAGANRDDLLADFRQAIERAIVEGRTLADFRKDFASIVARYGWS |
| A0A496NF26 | 1-92 | None |
| A0A7T3E4G5 | 2-86 | None |
| A0A6D0FRM1 | 7-80 | None |
| A0A1V5PMG4 | 14-113 | None |
| V4NR64 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.