DPCstruct | MC42279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 17.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287XKU2 | 87-193 | VPPGLVDELVEEALVWCSQHGLVVGDKNHPRSGKAPGVGLLHAPFALLPMSFPKVYWEQALELAPLFNELVHRVSLDGDFLQQTLAR… |
| I1NC20 | 83-196 | DQKLLQNIVYDALVWSTLNCLLVGDKSVQRSGRVPGVGLVHLPLSLLPGPFPESHWKQGCELAPIFNELVDRVSLDGKFLQESLSRT… |
| A0A2H2I6E8 | 17-123 | None |
| A0A4U5M0F6 | 13-117 | None |
| A0A287XKJ7 | 74-197 | None |
| A0A821CDP5 | 11-112 | None |
| A0A803Q021 | 7-120 | None |
| A0A7R9B7C0 | 1-84 | None |
| A0A1D6F7V7 | 2-118 | None |
| A0A835SD65 | 139-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.