DPCstruct | MC42271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 151 ± 19 aa |
| Standard deviation of domain lengths | 19.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5FLG4 | 21-153 | DSPRSLMTDWLVGGKLPPGLGWGDECELRDPVEAGAIVKCRRQDLESDEVREHLKSGKQVFQLGLELDQRMAFVLGEDLTIRKFRFL… |
| A0A2R3G070 | 39-186 | LALLRKSLGSLPVVPLAFANEPSTILTNWILQDNLPHWLLALEEAELRGSQEDSVIRCKKQPLENEEILALLQDGKKVVSKLALEWE… |
| A0A1Q9BX98 | 331-489 | None |
| A0A1N6LDD6 | 12-142 | None |
| G1V004 | 1-169 | None |
| A0A2D8RDX3 | 167-322 | None |
| A0A0J8I2W8 | 20-168 | None |
| A0A031HGZ7 | 1-138 | None |
| A0A1F9BEK7 | 1-156 | None |
| A0A4Q5XBX8 | 420-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.