DPCstruct | MC4227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8JYZ1 | 1-96 | ATKLQTPRLVSGVEFDGSRDITLTAAHVAAFARRATDTYADADGGVPWNAESGAYNVTRSGDSYILVNFYTGVGSCRTLQMKAHYRN… |
| A0A843PV46 | 18-113 | ATKLQTPRRVSGVEFDGSKDITLTAAHVAAFARRATDTYADADGGVPWNAESGAYNVTRSGDSYILVNFYTGVGSCRTLQMKAHYRN… |
| A0A6D0EXL5 | 330-425 | None |
| T0PBW9 | 5-97 | None |
| A0A7X5QP59 | 1-107 | None |
| A0A3T4D3C6 | 308-403 | None |
| A0A5B8HTX2 | 95-204 | None |
| A0A1S9J625 | 19-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.