DPCstruct | MC42265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 396 ± 138 aa |
| Standard deviation of domain lengths | 138.41 |
| Length coefficient of variation | 0.35 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3P6Q7 | 32-373 | ATLLVSMLIGAGHPALVVSGVAREETILNDQLAIPYPYPIVEVEAEEVKPKVEKQGQKYKLRGLPDLTSHLEEDMAEVHRQKEAEEK… |
| H9J5R5 | 1-294 | MSPYTVIIRRSGNPFELAHVLVSWLIGAGYDAYVVVGCATRDTCMAIKYRSICADIPDESEKKEEIPPPDEEPRYRLVPLPDLTSKY… |
| A0A7S4P1W1 | 36-485 | None |
| A0A7S4U8L7 | 129-666 | None |
| A0A662X5S7 | 81-579 | None |
| A0A1I8N926 | 145-578 | None |
| A0A484C0Y7 | 71-541 | None |
| A0A0L7KTG2 | 1-328 | None |
| A0A7J5ZJ17 | 55-515 | None |
| A0A7S0R7H1 | 306-1056 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.