DPCstruct | MC42262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 170 ± 22 aa |
| Standard deviation of domain lengths | 22.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4MZW2 | 4-172 | FYTGFSCLLHICMLNLLAQGGEKCWNGGTRSLNITMYCDPEAGPGFPSLIPGMPVEQKKCGYALQWRSQYACPLCTNEDMRTLPGEC… |
| A0A0L8FYM1 | 9-155 | GFEPGDEDIHFHYKAESPTAACQDGRETIITLRCDVKEDKRGTIDLPPKCPDGTCDGCTFHFLWRSQHACPVCREEDYDVIVSECIA… |
| A0A814CRK8 | 998-1170 | None |
| A0A0B1T587 | 140-307 | None |
| F6Z516 | 2-187 | None |
| A0A815W8L4 | 62-215 | None |
| A0A5J4VMB6 | 26-214 | None |
| W2PGK5 | 487-699 | None |
| A0A815FD11 | 813-986 | None |
| A0A7S1NM66 | 53-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.