DPCstruct | MC4226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 11.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0M1C9 | 1-85 | MSPGWRMDDHGKEALIFGSSQCPDANGNTTSEGGCVLIENHSETVAVIVVDATKQFRRQETWTIEHKKDRTIVMRPDNSYVMPWV |
| A0A831HFY8 | 94-216 | SAVGQIGTAALKLANVDAARPAIEIAPGMAIKNGNGQATVSGFQKCSEQSGVMRAIFGSASTDGRNDCIVIGNDTQTLEVQVHTRDG… |
| A0A2V3Q2G6 | 31-142 | None |
| A0A2L0XDG6 | 79-192 | None |
| A0A7X2BNC7 | 18-114 | None |
| A0A3N8E730 | 23-133 | None |
| A0A2G6ZRZ9 | 9-136 | None |
| A0A286T6S1 | 36-155 | None |
| A0A0U3JBX2 | 3-97 | None |
| A0A162B2E1 | 14-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.