DPCstruct | MC42251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 139 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U1ZD89 | 145-289 | LATVALLFATDSEQSWQGYAQLFKNWHQYPAVLRNVRGRLAIVQALFPESDQAQRAERFVQKAFDLFSEHLYDQIEPGDESDGDAFS… |
| A0A3M2CBE2 | 1-149 | MLLSGLAHLHVLFGTFSDQSWAGLRLIIERLGAERVRQDEPQADCLLVQAMVPENVEAAEKSKRDFGDRARDVFVDHFYKEDPEAEA… |
| A0A1F7LJY9 | 151-283 | None |
| A0A2K8NBJ8 | 180-326 | None |
| A0A450U1B5 | 19-127 | None |
| A0A5E4W321 | 120-270 | None |
| A0A2S6NH45 | 66-199 | None |
| A0A7X4F1E7 | 83-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.