DPCstruct | MC4225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831GE25 | 1-65 | MATNAKPVYKRILLKLSGEALQGSEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAG |
| K1ACV0 | 1-59 | MANPKYKRILIKLSGEALAGERGVGIDIQTVQTIAKEIQEVHSLGIEIALVIGGGNLWR |
| A0A4U6UU83 | 69-146 | None |
| A0A6A5L2V1 | 15-69 | None |
| T1U9Y1 | 1-61 | None |
| A0A357NPA9 | 1-59 | None |
| A0A420Z1U2 | 3-54 | None |
| A0A011P2T6 | 1-64 | None |
| A0A133ZPB4 | 268-325 | None |
| A0A6M1CIZ1 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.