DPCstruct | MC42248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 230 ± 55 aa |
| Standard deviation of domain lengths | 55.33 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 66.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4Q5B7 | 26-233 | SNQIGSEAQNCDLNYKGKCRGRKPKAGSELRDNSNHVVSQAHKHEHADRRVSKRVKKNVVPSAKGQKIGEGAKMESDDDDLHIGRLV… |
| A0A0A8YJX5 | 1-158 | MVNVFEFEGPLQEMKEEVVEEEQPLNMQATSSKGHHAVPQNTSELQGVIWPTHIMERPESEFKQKLMEVLNKPFNLAEYDDLLATAT… |
| A0A7I8KAX7 | 16-293 | None |
| A0A1D1YKR8 | 18-346 | None |
| A0A7N0TZE3 | 415-694 | None |
| A0A835R3F0 | 175-350 | None |
| G7IK21 | 330-525 | None |
| A0A287FYC3 | 1-170 | None |
| A0A3S3NI89 | 258-508 | None |
| A0A5P1F4I8 | 81-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.