DPCstruct | MC42246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 54 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 72.62 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF03386- CL0431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445D3Q3 | 8-59 | GAVIRGKKGLGGVTIKKTNQALIIGIYDELMTPGQCNMIVERLGDYLIDTGL |
| A0A6A4Q0I7 | 1-45 | MGPGGVTVKKTNQALIIGIYDEPMTPGQCNMVVERLGDYLIDQGL |
| A0A5J9VHH5 | 700-758 | None |
| A0A0E0JF32 | 73-131 | None |
| A0A287VP43 | 15-68 | None |
| A0A1R3H9E7 | 73-129 | None |
| A0A540KK50 | 160-213 | None |
| A0A803NU51 | 38-94 | None |
| A0A5P1FR11 | 368-426 | None |
| A0A5P1EP93 | 66-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.