DPCstruct | MC42245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 53.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4PYE6 | 1-95 | MISDWTPEDRQNLRNKVPMTGLRTPFQGRMLLHVAEDVLKWAKDGLDRRCLNESVFLDPLKEVVTTGSTPADKLLKMYNNKWRNNID… |
| A0A150G533 | 670-763 | ISDWTAEEREYLRTEVPRWGLRTPFRGGTIQDVAKQVIAIARGGLERRGHDEVSFLKRLEVIAETGLTQADHLLELYETKWQRSVDP… |
| K3XRW8 | 309-393 | None |
| A0A830CJ31 | 758-852 | None |
| A0A250XLH8 | 44-132 | None |
| A0A7N2M5P6 | 13-92 | None |
| A0A4S8JZZ4 | 312-406 | None |
| A0A2N9G2L3 | 1-88 | None |
| A0A2N9FJ04 | 82-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.