DPCstruct | MC42230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 214 ± 46 aa |
| Standard deviation of domain lengths | 46.30 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 65.97 |
| Assigned Pfam label(s) | CL0031- CL0340- CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484Y8G2 | 2-220 | GVLLAYMFFGRGSAKQSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSILAVLAMTPKGAY… |
| R5TGC8 | 156-289 | LGVLLAYMFFCKDKKTKQSAPGAVIIHVLGGIHEIYFPYILMNPLVIIAPIVGNMAAVFWFNLTDCGLVGPASPGSIIAYLMMTPGP… |
| A0A0N0I528 | 2-176 | None |
| U7VC40 | 377-628 | None |
| A0A1Q2D0J5 | 23-233 | None |
| A0A6N6X7A9 | 2-165 | None |
| A0A1Q9YEH9 | 78-250 | None |
| A0A1Q6U7E7 | 2-212 | None |
| A0A7X2MDX8 | 28-252 | None |
| A0A116R1B7 | 39-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.