DPCstruct | MC4223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 5.82 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12487 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2KN49 | 3-110 | FESEIAAARGHISANELDAAMANLERAHVIGQQHVWPHVLSHWLMLRIELQRGRAAAAFGQLLRIALGALGSALDLVPTGNPGGSDI… |
| A0A7Y5UMK0 | 2-100 | AEAARHRSAGDANSAFAALERAHVLGQLDFVPHLRVHWQMLRAGWAAGDRREVAGQLMRIALVPVGHLVGRLPVGNTGGSNVSAFKP… |
| A0A328C5J1 | 11-119 | None |
| A0A841HRX6 | 6-113 | None |
| A0A2D5FTL7 | 9-122 | None |
| A0A1B1YXC3 | 20-126 | None |
| A0A1W2GEV5 | 49-158 | None |
| A0A2E0RVB6 | 250-357 | None |
| A0A4Q0NZ06 | 3-90 | None |
| A0A448Y2C6 | 71-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.