DPCstruct | MC42223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17503 |
|---|---|
| Mean domain length (aa) | 261 ± 60 aa |
| Standard deviation of domain lengths | 60.04 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.77 |
| Pfam Score | 97.56 |
| Assigned Pfam label(s) | PF06146- PF08492- CL0003- CL0219- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7YGW6 | 11-299 | ITGRLGQGGMGEIFSARDEKLDRTVAVKFIANSRLDSDASRRLFLREARAAAALDHPFICSVHDVLEHGGQPVIIMERVEGETLSER… |
| A0A6L3MDG4 | 3-240 | LLGEVYNAAGEHWDLHLKGAGMTPYSRMGDGRAVLRSSIREFLASEALHALGIPSSRALCVIGSDTPVWREKQERGAMILRLAPSHI… |
| C3ZV57 | 473-845 | None |
| C3ZTH6 | 69-330 | None |
| C3ZQY6 | 928-1207 | None |
| C3ZPP6 | 882-1165 | None |
| C3ZKK1 | 30-333 | None |
| C3ZGJ7 | 1007-1244 | None |
| A0A7V2WU76 | 10-263 | None |
| A0A7W1BMR6 | 3-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.