DPCstruct | MC42222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 174 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I8EZ96 | 1-194 | MLSGSPGGPTGALTSLFGGTRAIDQLMSLSQRPEMAMALGALGLGKLGRQSIDVGPSRVPVPTAAFPNLYAQLADQVVTEAAELAGD… |
| A0A2V7YA66 | 1-181 | MPQPYDQIGMLIQALRQHQIPPLPGLVPAVPPAVPQADGLGLLRMILGNPQFQQAMHFASVLGPAAPRTVQLPVPTGAVPGTRSVAI… |
| A0A849EQT3 | 197-366 | None |
| A0A3N1JIT4 | 93-281 | None |
| A0A2T1D180 | 1-177 | None |
| A0A246JE69 | 189-354 | None |
| A0A370WY82 | 83-243 | None |
| A0A4P7LH56 | 209-372 | None |
| A0A6G9YLP9 | 47-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.