DPCstruct | MC42220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 472 ± 77 aa |
| Standard deviation of domain lengths | 77.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0328- PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090W630 | 1-409 | MNTLASEFLRKLSRKPYFKYTENGKSIRYSANQAFLAMQSAPNIWQYVPLIKVDPKKGGELFSNLSINENGLVSFSELLEKEGKYLL… |
| A0A2V7XVV8 | 1-447 | MMTQKRRIGTTTPLFCAVAVTLSALAATDARAATPVDALRTVAIQDGGRIKPLDTFSRETARRITGARAFGAESVRGLDPVEWVVAM… |
| A0A6B2M5B9 | 9-516 | None |
| A0A2V8ER12 | 2-440 | None |
| A0A520LF05 | 58-721 | None |
| A0A2D5B8Z1 | 152-686 | None |
| A0A800APL9 | 98-581 | None |
| A0A2K1L3R7 | 16-445 | None |
| A0A2A5AD89 | 22-428 | None |
| A0A2V2S4K8 | 2-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.