DPCstruct | MC42215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 167 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03611 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HYS7 | 1-159 | LVTRMTRVVNVDIWNIWHMTFTGAMLHIASGSYWIGILGVVVHAAFVYKLGDWFAKDTRDFFGLEGIAIPHGSSAYLGPVAVLVDTI… |
| A0A081BHL2 | 19-194 | ASAVAFGTEIGALVIPLGLLLNVVMLVTKTTKTLNIDLFNYWHYAFVGSLVSIETNSFWWGAFAAAITYIISMVAADRTQKKMENFY… |
| R7D5U0 | 88-264 | None |
| A0A7K3JCK0 | 84-257 | None |
| A0A828Y8Z5 | 88-261 | None |
| A0A5D0EHV6 | 390-538 | None |
| A0A1L8SV35 | 77-252 | None |
| A0A379TZA9 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.