DPCstruct | MC42208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 230 ± 15 aa |
| Standard deviation of domain lengths | 15.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381GME1 | 1-258 | MSKMLNTAQAAIEWVTDTRQRAARLDDEADALLAQLTLVAVNESALKTTFSSRGCVGLYGHSQSAKAHLLTALCSNANGKVNIVTPD… |
| A0A3S6EXR8 | 24-263 | IDHSFGWIESCRQQAPRLDTEAERLKIKLRRHRSEAQRLSVISSEAMTIGFFGQSQQGKSALITALTTNGDNKLETRLGDKTYDYLM… |
| A0A484ZAX8 | 1-240 | None |
| A0A7X3NB15 | 16-223 | None |
| A0A455VN62 | 3-219 | None |
| A0A8B3HLH8 | 19-265 | None |
| A0A448SS45 | 22-245 | None |
| A0A0D8LD63 | 5-225 | None |
| A0A143HUP1 | 2-216 | None |
| A0A4U9HHV9 | 15-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.