DPCstruct | MC42204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.66 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF00032- CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2U5P2 | 1-71 | MLFAWFLFFAPHYLSSADNFIPADPTITPAIVAPEWYFLPFFSILRCFPNEFVGLAAMCGSILIFYFSSLA |
| A0A0F3M7Z1 | 51-120 | FFGFGIYFLIFSAFIFYQPNYLGHPDNYIPADPLLTPHHIVPEWYFLPFYAILRAVPSKLGGITLMFSSI |
| A0A2A9LWI3 | 1-57 | None |
| A0A446KBA5 | 191-252 | None |
| A0A2A9M4D7 | 23-91 | None |
| A0A2A9M0D1 | 1-79 | None |
| A0A2A9LYP6 | 2-68 | None |
| L8HP59 | 394-460 | None |
| A0A2A9LWE6 | 44-109 | None |
| A0A2P5XYD1 | 303-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.