DPCstruct | MC4220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8G1C7 | 25-116 | QQSEKHPDVDWSLGCQECHSEMTPEVYNDWYTSRHGMVNFGCYICHGDGQETFYAKGSDAQCGGCHAGQLVSFDSSKFKSCFDCHNG… |
| A0A7I9VIV5 | 31-132 | PRATPRPAAAAQGAHPEVDTGLATCAECHAEVTPEVAAQWRGGRHGVALVKCFICHGSTGADFRARPEPAGCGSCHPVQAAGAAQAR… |
| A0A7U3YLD9 | 22-120 | None |
| B8IYC8 | 46-128 | None |
| A0A7Y5NFZ7 | 36-134 | None |
| A0A3M1ASC9 | 37-150 | None |
| A0A3D1AIY6 | 7-101 | None |
| A0A4U0ZPV5 | 8-106 | None |
| A0A7C4ATG1 | 57-149 | None |
| A0A2E3R9M7 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.