DPCstruct | MC422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 18.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8RE86 | 62-197 | TESESLARDIKEGTLTGFVGNGTALTGEASFKGMLRVDGALSGRVSSADGTLIVSTNGRVDANVEVAVAQIYGTVNGDITASKRIEM… |
| W7XAG6 | 10-128 | KQQSLEAITSFVAENTRVKGDLEAMEGEDLGIKIDGTVLGSIKIPKGGTVHIGPTGSVEGELIEADYIFVEGRVTGTILSRRGVELS… |
| A0A0J1G7M7 | 881-997 | None |
| B3DUR2 | 48-159 | None |
| R5TDF8 | 2-115 | None |
| A0A7C6SYX9 | 59-189 | None |
| A0A850KDD2 | 3-117 | None |
| A0A2E8Q2B0 | 1-128 | None |
| A0A523A1A7 | 24-196 | None |
| A0A1H5SS12 | 401-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.