DPCstruct | MC42196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 200 ± 25 aa |
| Standard deviation of domain lengths | 24.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420MB11 | 1-182 | MADTVELLGVIGTWVAVVLALVALAGIIPIYILYRQSQTERHVALDAVDDRLNEYVTRGYELLPRKRFFRSVRVPDLTETPKLNAVD… |
| A0A6A5V9W6 | 1-203 | MAEPIDLASMIRTWVAAALAIIALFGVVGPWLVWRNLRSERNLALTTVNYRSSKFVSKGIRIKDRAYALKKVTVPYLSEPPKLRGFA… |
| A0A2H3HDD1 | 9-244 | None |
| A0A4Q4P0F3 | 1-211 | None |
| A0A225AIK3 | 49-216 | None |
| A0A6A5TLL1 | 1-208 | None |
| A0A2T2NQ43 | 177-397 | None |
| A0A093VS38 | 1-166 | None |
| A0A0D2DLG8 | 5-178 | None |
| A0A7C8INK1 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.